HSPA13, Recombinant, Human, aa23-471, GST-Tag (Heat Shock 70kD Protein 13)

Catalog Number: USB-373698
Article Name: HSPA13, Recombinant, Human, aa23-471, GST-Tag (Heat Shock 70kD Protein 13)
Biozol Catalog Number: USB-373698
Supplier Catalog Number: 373698
Alternative Catalog Number: USB-373698-20,USB-373698-100,USB-373698-1
Manufacturer: US Biological
Category: Molekularbiologie
Has peptide-independent ATPase activity. Source: Recombinant protein corresponding to aa23-471 from human HSPA13, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~76.6kD Amino Acid Sequence: QQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 76.6
UniProt: P48723
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.