HSPB2, Recombinant, Human, aa1-182, GST-Tag (Heat Shock Protein beta-2)

Catalog Number: USB-373702
Article Name: HSPB2, Recombinant, Human, aa1-182, GST-Tag (Heat Shock Protein beta-2)
Biozol Catalog Number: USB-373702
Supplier Catalog Number: 373702
Alternative Catalog Number: USB-373702-20, USB-373702-100, USB-373702-1
Manufacturer: US Biological
Category: Molekularbiologie
May regulate the kinase DMPK. Source: Recombinant protein corresponding to aa1-182 from human HSPB2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.2kD Amino Acid Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.2
UniProt: Q16082
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.