Hup1, Recombinant, Streptomyces Lividans, aa1-93, GST-Tag (DNA-binding Protein HU 1)
Biozol Catalog Number:
USB-373707
Supplier Catalog Number:
373707
Alternative Catalog Number:
USB-373707-20,USB-373707-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extre environmental conditions. Source: Recombinant protein corresponding to aa1-93 from streptomyces lividans DNA-binding Protein HU 1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.9kD Amino Acid Sequence: MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEKVTIPGFLTFERTHRAARTARNPQTGEPIQIPAGYSVKVSAGSKLKEAAKGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted