Hydrophobin, Recombinant, Neosartorya fumigata, aa19-159, His-Tag (RodA)

Catalog Number: USB-373714
Article Name: Hydrophobin, Recombinant, Neosartorya fumigata, aa19-159, His-Tag (RodA)
Biozol Catalog Number: USB-373714
Supplier Catalog Number: 373714
Alternative Catalog Number: USB-373714-20,USB-373714-100
Manufacturer: US Biological
Category: Molekularbiologie
Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia. Source: Recombinant protein corresponding to aa19-159 from neosartorya fumigata rodA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.3kD Amino Acid Sequence: LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.3
UniProt: P41746
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.