ICT1, Recombinant, Human, aa30-206, His-SUMO-Tag (Peptidyl-tRNA hydrolase ICT1, Mitochondrial)

Catalog Number: USB-373724
Article Name: ICT1, Recombinant, Human, aa30-206, His-SUMO-Tag (Peptidyl-tRNA hydrolase ICT1, Mitochondrial)
Biozol Catalog Number: USB-373724
Supplier Catalog Number: 373724
Alternative Catalog Number: USB-373724-20,USB-373724-100,USB-373724-1
Manufacturer: US Biological
Category: Molekularbiologie
Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes. Source: Recombinant protein corresponding to aa30-206 from human ICT1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.4kD Amino Acid Sequence: LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36.4
UniProt: Q14197
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.