ID-1, Recombinant, Human, aa1-155, His-SUMO-Tag (DNA-binding Protein Inhibitor ID1)

Catalog Number: USB-373725
Article Name: ID-1, Recombinant, Human, aa1-155, His-SUMO-Tag (DNA-binding Protein Inhibitor ID1)
Biozol Catalog Number: USB-373725
Supplier Catalog Number: 373725
Alternative Catalog Number: USB-373725-20,USB-373725-100,USB-373725-1
Manufacturer: US Biological
Category: Molekularbiologie
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Source: Recombinant protein corresponding to aa1-155 from human ID-1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.1kD Amino Acid Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.1
UniProt: P41134
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.