IDH3G, Recombinant, Human, aa40-393, His-SUMO-Tag (Isocitrate Dehydrogenase [NAD] Subunit gamma, Mitochondrial)

Catalog Number: USB-373729
Article Name: IDH3G, Recombinant, Human, aa40-393, His-SUMO-Tag (Isocitrate Dehydrogenase [NAD] Subunit gamma, Mitochondrial)
Biozol Catalog Number: USB-373729
Supplier Catalog Number: 373729
Alternative Catalog Number: USB-373729-20,USB-373729-100,USB-373729-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa40-393 from human IDH3G, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.8kD Amino Acid Sequence: FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 54.8
UniProt: P51553
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.