IFI6, Recombinant, Human, aa24-130, His-B2M-Tag (Interferon alpha-inducible Protein 6)

Catalog Number: USB-373737
Article Name: IFI6, Recombinant, Human, aa24-130, His-B2M-Tag (Interferon alpha-inducible Protein 6)
Biozol Catalog Number: USB-373737
Supplier Catalog Number: 373737
Alternative Catalog Number: USB-373737-20,USB-373737-100,USB-373737-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.4kD Amino Acid Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.4
UniProt: P09912
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.