IFI6, Recombinant, Human, aa24-130, His-Tag (Interferon alpha-inducible Protein 6)

Catalog Number: USB-373738
Article Name: IFI6, Recombinant, Human, aa24-130, His-Tag (Interferon alpha-inducible Protein 6)
Biozol Catalog Number: USB-373738
Supplier Catalog Number: 373738
Alternative Catalog Number: USB-373738-20,USB-373738-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.3kD AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.3
UniProt: P09912
Purity: ~85% (SDS-PAGE)
Form: Supplied as a liquid in Tris-HCl, 0.5M sodium chloride pH 8.0, 20% glycerol.