Insulin-Like Growth Factor I, Recombinant, Human, aa49-118, GST-Tag (IGF1)

Catalog Number: USB-373766
Article Name: Insulin-Like Growth Factor I, Recombinant, Human, aa49-118, GST-Tag (IGF1)
Biozol Catalog Number: USB-373766
Supplier Catalog Number: 373766
Alternative Catalog Number: USB-373766-20,USB-373766-100,USB-373766-1
Manufacturer: US Biological
Category: Molekularbiologie
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Full-length recombinant protein corresponding to aa49-118 of human Insulin-Like Growth Factor I, fused to GST-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P05019. Molecular Weight: ~34.7kD Amino Acid Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.7
UniProt: P05019
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, 50% glycerol.