IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)

Catalog Number: USB-373779
Article Name: IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)
Biozol Catalog Number: USB-373779
Supplier Catalog Number: 373779
Alternative Catalog Number: USB-373779-20,USB-373779-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD Amino Acid Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 42.3
UniProt: G1SLF2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.