IL10, Recombinant, Sheep, aa20-177, His-Tag (Interleukin-10)

Catalog Number: USB-373785
Article Name: IL10, Recombinant, Sheep, aa20-177, His-Tag (Interleukin-10)
Biozol Catalog Number: USB-373785
Supplier Catalog Number: 373785
Alternative Catalog Number: USB-373785-20,USB-373785-100
Manufacturer: US Biological
Category: Molekularbiologie
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Source: Recombinant protein corresponding to aa20-177 from sheep IL10, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.4kD Amino Acid Sequence: SRDASTLSDSSCTHFPASLPHMLRDVRAAFGKVKTFFQMKDQLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMTTKM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.4
UniProt: Q29408
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.