IL29, Recombinant, Human, aa21-200, His-SUMO-Tag (Interleukin-29)

Catalog Number: USB-373817
Article Name: IL29, Recombinant, Human, aa21-200, His-SUMO-Tag (Interleukin-29)
Biozol Catalog Number: USB-373817
Supplier Catalog Number: 373817
Alternative Catalog Number: USB-373817-20,USB-373817-100,USB-373817-1
Manufacturer: US Biological
Category: Molekularbiologie
Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagent leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression. Partial recombinant protein corresponding to aa21-200 from human IL29, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accession: Q8IU54 Molecular Weight: ~36.0kD Amino Acid Sequence: PVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36
UniProt: Q8IU54
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.