IL36RN, Recombinant, Human, aa1-155, His-SUMO-Tag (Interleukin-36 Receptor Antagonist Protein)

Catalog Number: USB-373823
Article Name: IL36RN, Recombinant, Human, aa1-155, His-SUMO-Tag (Interleukin-36 Receptor Antagonist Protein)
Biozol Catalog Number: USB-373823
Supplier Catalog Number: 373823
Alternative Catalog Number: USB-373823-20,USB-373823-100,USB-373823-1
Manufacturer: US Biological
Category: Molekularbiologie
Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response, similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. Source: Recombinant protein corresponding to aa1-155 from human IL36RN, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD Amino Acid Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33
UniProt: Q9UBH0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.