IRGM, Recombinant, Human, aa1-178, GST-Tag (Immunity-related GTPase Family M Protein)
Biozol Catalog Number:
USB-373864
Supplier Catalog Number:
373864
Alternative Catalog Number:
USB-373864-20,USB-373864-100,USB-373864-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility. Recombinant protein corresponding to aa1-178 from human IRGM, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~47.1kD Amino Acid Sequence: MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
