JAK1, Recombinant, Mouse, aa848-1152, His-Tag (Tyrosine-Protein Kinase Jak1)

Catalog Number: USB-373885
Article Name: JAK1, Recombinant, Mouse, aa848-1152, His-Tag (Tyrosine-Protein Kinase Jak1)
Biozol Catalog Number: USB-373885
Supplier Catalog Number: 373885
Alternative Catalog Number: USB-373885-20,USB-373885-100
Manufacturer: US Biological
Category: Molekularbiologie
Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Source: Recombinant protein corresponding to aa848-1152 from mouse Jak1, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~39.1kD Amino Acid Sequence: EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.1
UniProt: P52332
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.