JAM2, Recombinant, Human, aa29-238, His-Tag (Junctional Adhesion Molecule B)
Biozol Catalog Number:
USB-373889
Supplier Catalog Number:
373889
Alternative Catalog Number:
USB-373889-20,USB-373889-100,USB-373889-1
Manufacturer:
US Biological
Category:
Molekularbiologie
May play a role in the processes of lymphocyte homing to secondary lymphoid organs. Source: Recombinant protein corresponding to aa29-238 from human JAM2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD Amino Acid Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted