JTB, Recombinant, Brugia malayi, aa31-105, His-SUMO-Tag (Protein JTB)

Catalog Number: USB-373893
Article Name: JTB, Recombinant, Brugia malayi, aa31-105, His-SUMO-Tag (Protein JTB)
Biozol Catalog Number: USB-373893
Supplier Catalog Number: 373893
Alternative Catalog Number: USB-373893-20,USB-373893-100
Manufacturer: US Biological
Category: Molekularbiologie
Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Source: Recombinant protein corresponding to aa31-105 from brugia malayi JTB, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.4kD Amino Acid Sequence: EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.4
UniProt: O77049
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.