KCTD15, Recombinant, Human, aa1-234, GST-Tag (BTB/POZ Domain-containing protein KCTD15)

Catalog Number: USB-373907
Article Name: KCTD15, Recombinant, Human, aa1-234, GST-Tag (BTB/POZ Domain-containing protein KCTD15)
Biozol Catalog Number: USB-373907
Supplier Catalog Number: 373907
Alternative Catalog Number: USB-373907-20,USB-373907-100,USB-373907-1
Manufacturer: US Biological
Category: Molekularbiologie
During embryonic development, interferes with neural crest formation. Inhibits AP2 transcriptional activity by interaction with its activation domain. Source: Recombinant protein corresponding to aa1-234 from human KCTD15, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~53.5kD Amino Acid Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 53.5
UniProt: Q96SI1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.