KHK, Recombinant, Human, aa1-298, GST-Tag (Ketohexokinase)

Catalog Number: USB-373914
Article Name: KHK, Recombinant, Human, aa1-298, GST-Tag (Ketohexokinase)
Biozol Catalog Number: USB-373914
Supplier Catalog Number: 373914
Alternative Catalog Number: USB-373914-20,USB-373914-100,USB-373914-1
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate. Source: Recombinant protein corresponding to aa1-298 from human KHK, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.7kD Amino Acid Sequence: MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 59.7
UniProt: P50053
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.