KIR2DS1, Recombinant, Human, aa22-245, His-Tag (Killer Cell Immunoglobulin-like Receptor 2DS1)

Product Overview

• Article Name: KIR2DS1, Recombinant, Human, aa22-245, His-Tag (Killer Cell Immunoglobulin-like Receptor 2DS1)
• Biozol Catalog Number: USB-373921
• Supplier Catalog Number: 373921
• Alternative Catalog Number: USB-373921-20,USB-373921-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Source: Partial recombinant protein corresponding to aa22-245 from human KIR2DS1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.8kD AA Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 26.8
• UniProt: Q14954
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.