Klk7, Recombinant, Rat, aa25-261, His-Tag (Glandular Kallikrein-7, Submandibular/renal)

Product Overview

• Article Name: Klk7, Recombinant, Rat, aa25-261, His-Tag (Glandular Kallikrein-7, Submandibular/renal)
• Biozol Catalog Number: USB-373935
• Supplier Catalog Number: 373935
• Alternative Catalog Number: USB-373935-20,USB-373935-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney. Source: Recombinant protein corresponding to aa25-261 from rat Klk7, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.3kD Amino Acid Sequence: VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 30.3
• UniProt: P36373
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.