KLRG1, Recombinant, Human, aa60-195, His-SUMO-Tag (Killer Cell Lectin-like Receptor Subfamily G Member 1)

Catalog Number: USB-373940
Article Name: KLRG1, Recombinant, Human, aa60-195, His-SUMO-Tag (Killer Cell Lectin-like Receptor Subfamily G Member 1)
Biozol Catalog Number: USB-373940
Supplier Catalog Number: 373940
Alternative Catalog Number: USB-373940-20,USB-373940-100,USB-373940-1
Manufacturer: US Biological
Category: Molekularbiologie
Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. Recombinant protein corresponding to aa60-195 from human KLRG1, fused to an N-terminal 6X His-SUMO-Tag, expressed in E. coli. Uniprot/Accession: Q96E93 Molecular Weight: ~31.5kD Amino Acid Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.5
UniProt: Q96E93
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol