L1, Recombinant, Human, aa358-533, His-Tag (Papillomavirus Type 18 L1 Protein)

Catalog Number: USB-373970
Article Name: L1, Recombinant, Human, aa358-533, His-Tag (Papillomavirus Type 18 L1 Protein)
Biozol Catalog Number: USB-373970
Supplier Catalog Number: 373970
Alternative Catalog Number: USB-373970-20,USB-373970-100,USB-373970-1
Manufacturer: US Biological
Category: Molekularbiologie
Forms an icosahedral capsid with a T=7 symmetry and about 55 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with L2 proteins. The capsid encapsulates the genomic DNA, but does not bind DNA. Essential for the initial attachment to the host cell. Source: Partial recombinant protein corresponding to aa358-533 from human Papillomavirus Type 18 L1 Protein, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.1kD Amino Acid Sequence: GSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.1
UniProt: P06794
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.