L1CAM, Recombinant, Human, aa1003-1114, His-Tag (Neural Cell Adhesion Molecule L1 Protein)

Catalog Number: USB-373972
Article Name: L1CAM, Recombinant, Human, aa1003-1114, His-Tag (Neural Cell Adhesion Molecule L1 Protein)
Biozol Catalog Number: USB-373972
Supplier Catalog Number: 373972
Alternative Catalog Number: USB-373972-20,USB-373972-100
Manufacturer: US Biological
Category: Molekularbiologie
Cell adhesion molecule with an important role in the development of the nervous system. Involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. Binds to axonin on neurons. Source: Partial recombinant protein corresponding to aa1003-1114 from human L1CAM, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.5kD AA Sequence: EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.5
UniProt: P32004
Purity: ~90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.