L2HGDH, Recombinant, Human, aa52-463, His-SUMO-Tag (L-2-hydroxyglutarate Dehydrogenase, Mitochondrial)

Catalog Number: USB-373976
Article Name: L2HGDH, Recombinant, Human, aa52-463, His-SUMO-Tag (L-2-hydroxyglutarate Dehydrogenase, Mitochondrial)
Biozol Catalog Number: USB-373976
Supplier Catalog Number: 373976
Alternative Catalog Number: USB-373976-20,USB-373976-100,USB-373976-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa52-463 from human L2HGDH, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~61.3kD Amino Acid Sequence: VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 61.3
UniProt: Q9H9P8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.