Hydrolyzes L-prolinamide, L-proline-p-nitroanilide, L-alaninamide, L-methioninamide, piperidine-2-carboxamide and piperazine-2-carboxamide. Has a much lower activity towards piperazine-2-tert-butylcarboxamide. Does not hydrolyze dipeptides and D-prolinamide. Recombinant protein corresponding to aa1-310 from full length Pseudomonas azotoformans LaaA, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~54.5kD Amino Acid Sequence: MEFIEKIREGYAAFGAYQTWYRVTGDLSSGRTPLVVIHGGPGCTHDYVDAFKDVAASGHAVIHYDQLGNGRSTHLPDKDPSFWTVGLFLEELNNLLDHLQISDNYAILGQSWGGMLGSEHAILQPKGLRAFIPANSPTCMRTWVSEANRLRKLLPEGVHETLLKHETAGTYQDPEYLAASRVFYDHHVCRVIPWPEEVARTFAAVDADPTVYHAMSGPTEFHVIGSLKDWKSTGRLSAINVPTLVISGRHDEATPLVVKPFLDEIADVRWALFEDSSHMPHVEERQACMGTVVKFLDEVCSAKYKVLKAS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
