LDHC, Recombinant, Human, aa2-332, His-SUMO-Tag (L-lactate Dehydrogenase C Chain)

Catalog Number: USB-374004
Article Name: LDHC, Recombinant, Human, aa2-332, His-SUMO-Tag (L-lactate Dehydrogenase C Chain)
Biozol Catalog Number: USB-374004
Supplier Catalog Number: 374004
Alternative Catalog Number: USB-374004-20,USB-374004-100
Manufacturer: US Biological
Category: Molekularbiologie
Possible role in sperm motility. (S)-lactate + NAD+ = pyruvate + NADH. Source: Recombinant protein corresponding to aa2-332 from human LDHC, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.2kD Amino Acid Sequence: STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 52.2
UniProt: P07864
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.