LepB, Recombinant, Mycobacterium Tuberculosis, aa88-294, His-Tag (Signal Peptidase I)

Catalog Number: USB-374009
Article Name: LepB, Recombinant, Mycobacterium Tuberculosis, aa88-294, His-Tag (Signal Peptidase I)
Biozol Catalog Number: USB-374009
Supplier Catalog Number: 374009
Alternative Catalog Number: USB-374009-20,USB-374009-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa88-294 from mycobacterium tuberculosis lepB, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.6kD Amino Acid Sequence: RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.6
UniProt: P9WKA1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.