LexA Repressor, Recombinant, E. coli, aa1-202, His-SUMO-Tag (LexA)

Product Overview

• Article Name: LexA Repressor, Recombinant, E. coli, aa1-202, His-SUMO-Tag (LexA)
• Biozol Catalog Number: USB-374013
• Supplier Catalog Number: 374013
• Alternative Catalog Number: USB-374013-20,USB-374013-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5-CTGTATATATATACAG-3. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment. The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA. Source: Recombinant protein corresponding to aa1-202 from E. coli lexA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.4kD Amino Acid Sequence: MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38.4
• UniProt: P0A7C2
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.