Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)

Catalog Number: USB-374022
Article Name: Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)
Biozol Catalog Number: USB-374022
Supplier Catalog Number: 374022
Alternative Catalog Number: USB-374022-20,USB-374022-100
Manufacturer: US Biological
Category: Molekularbiologie
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. Source: Recombinant protein corresponding to aa2-136 from mouse Lgals7, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19kD Amino Acid Sequence: SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19
UniProt: O54974
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.