LHB, Recombinant, Bovine, aa21-141, His-Tag (Lutropin Subunit beta)

Catalog Number: USB-374031
Article Name: LHB, Recombinant, Bovine, aa21-141, His-Tag (Lutropin Subunit beta)
Biozol Catalog Number: USB-374031
Supplier Catalog Number: 374031
Alternative Catalog Number: USB-374031-20,USB-374031-100
Manufacturer: US Biological
Category: Molekularbiologie
Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. Source: Recombinant protein corresponding to aa21-141 from bovine LHB, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~17kD Amino Acid Sequence: SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 17
UniProt: P04651
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.