MDC1, Recombinant, Human, aa1892-2082, His-SUMO-Tag (Mediator of DNA Damage Checkpoint Protein 1)

Catalog Number: USB-374171
Article Name: MDC1, Recombinant, Human, aa1892-2082, His-SUMO-Tag (Mediator of DNA Damage Checkpoint Protein 1)
Biozol Catalog Number: USB-374171
Supplier Catalog Number: 374171
Alternative Catalog Number: USB-374171-20,USB-374171-100
Manufacturer: US Biological
Category: Molekularbiologie
Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by Ser-139 phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1. Source: Recombinant protein corresponding to aa1892-2082 from human MDC1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.9kD Amino Acid Sequence: APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36.9
UniProt: Q14676
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.