MDC1, Recombinant, Human, aa1892-2082, His-Tag (Mediator of DNA Damage Checkpoint Protein 1)

Product Overview

• Article Name: MDC1, Recombinant, Human, aa1892-2082, His-Tag (Mediator of DNA Damage Checkpoint Protein 1)
• Biozol Catalog Number: USB-374172
• Supplier Catalog Number: 374172
• Alternative Catalog Number: USB-374172-20,USB-374172-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by Ser-139 phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1. Source: Recombinant protein corresponding to aa1892-2082 from human MDC1, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~22.9kD Amino Acid Sequence: APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 22.9
• UniProt: Q14676
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.