MecA, Recombinant, Staphylococcus aureus, aa1-239, His-SUMO-Tag (Adapter Protein MecA)
Biozol Catalog Number:
USB-374183
Supplier Catalog Number:
374183
Alternative Catalog Number:
USB-374183-20,USB-374183-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Source: Recombinant protein corresponding to aa1-239 from staphylococcus aureus mecA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.3kD Amino Acid Sequence: MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted