Metallo-beta-lactamase Type 2, Recombinant, Serratia Marcescens, aa20-246, His-SUMO-Tag, Myc-Tag

Catalog Number: USB-374190
Article Name: Metallo-beta-lactamase Type 2, Recombinant, Serratia Marcescens, aa20-246, His-SUMO-Tag, Myc-Tag
Biozol Catalog Number: USB-374190
Supplier Catalog Number: 374190
Alternative Catalog Number: USB-374190-20,USB-374190-100
Manufacturer: US Biological
Category: Molekularbiologie
Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Source: Partial recombinant protein corresponding to aa20-246 from serratia marcescens Metallo-beta-lactamase type 2, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~45kD Amino Acid Sequence: ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 45
NCBI: 003159548
UniProt: P52699
Purity: ~90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.