MFAP5, Recombinant, Human, aa22-173, His-SUMO-Tag (Microfibrillar-associated Protein 5)

Product Overview

• Article Name: MFAP5, Recombinant, Human, aa22-173, His-SUMO-Tag (Microfibrillar-associated Protein 5)
• Biozol Catalog Number: USB-374197
• Supplier Catalog Number: 374197
• Alternative Catalog Number: USB-374197-20,USB-374197-100,USB-374197-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity. Component of the elastin-associated microfibrils. Source: Recombinant protein corresponding to aa22-173 from human MFAP5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.3kD Amino Acid Sequence: IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 33.3
• UniProt: Q13361
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.