Mite Group 2 Allergen Lep d 2, Recombinant, Lepidoglyphus Destructor, aa17-141, His-SUMO-Tag

Product Overview

• Article Name: Mite Group 2 Allergen Lep d 2, Recombinant, Lepidoglyphus Destructor, aa17-141, His-SUMO-Tag
• Biozol Catalog Number: USB-374217
• Supplier Catalog Number: 374217
• Alternative Catalog Number: USB-374217-20,USB-374217-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa17-141 from lepidoglyphus destructor, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.1kD Amino Acid Sequence: GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 29.1
• UniProt: P80384
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.