Mmp7, Recombinant, Rat, aa98-267, His-Tag (Matrilysin)

Product Overview

• Article Name: Mmp7, Recombinant, Rat, aa98-267, His-Tag (Matrilysin)
• Biozol Catalog Number: USB-374243
• Supplier Catalog Number: 374243
• Alternative Catalog Number: USB-374243-20,USB-374243-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. Source: Recombinant protein corresponding to aa98-267 from rat Matrilysin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.9kD Amino Acid Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.9
• UniProt: P50280
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.