MRPL42, Recombinant, Human, aa33-142, GST-Tag (39S Ribosomal Protein L42, Mitochondrial)

Product Overview

• Article Name: MRPL42, Recombinant, Human, aa33-142, GST-Tag (39S Ribosomal Protein L42, Mitochondrial)
• Biozol Catalog Number: USB-374271
• Supplier Catalog Number: 374271
• Alternative Catalog Number: USB-374271-20,USB-374271-100,USB-374271-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to a33-142 from human MRPL42, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.1kD Amino Acid Sequence: KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 40.1
• UniProt: Q9Y6G3
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.