MRPL54, Recombinant, Human, aa15-138, His-Tag (39S Ribosomal Protein L54, Mitochondrial)

Catalog Number: USB-374272
Article Name: MRPL54, Recombinant, Human, aa15-138, His-Tag (39S Ribosomal Protein L54, Mitochondrial)
Biozol Catalog Number: USB-374272
Supplier Catalog Number: 374272
Alternative Catalog Number: USB-374272-20,USB-374272-100,USB-374272-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa15-138 from human MRPL54, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.2kD Amino Acid Sequence: GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.2
UniProt: Q6P161
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.