MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S Ribosomal Protein L55, Mitochondrial)

Product Overview

• Article Name: MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S Ribosomal Protein L55, Mitochondrial)
• Biozol Catalog Number: USB-374273
• Supplier Catalog Number: 374273
• Alternative Catalog Number: USB-374273-20,USB-374273-100,USB-374273-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa34-128 from human MRPL55, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD Amino Acid Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38.6
• UniProt: Q7Z7F7
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.