Mt2, Recombinant, Danio rerio, aa1-60, His-Tag (Metallothionein-2)

Catalog Number: USB-374299
Article Name: Mt2, Recombinant, Danio rerio, aa1-60, His-Tag (Metallothionein-2)
Biozol Catalog Number: USB-374299
Supplier Catalog Number: 374299
Alternative Catalog Number: USB-374299-20,USB-374299-100
Manufacturer: US Biological
Category: Molekularbiologie
Metallothioneins have a high content of cysteine residues that bind various heavy metals. Source: Recombinant full length protein corresponding to aa1-60 from danio rerio Metallothionein-2, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8kD Amino Acid Sequence: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 8
UniProt: Q7ZSY6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.