MTFP1, Recombinant, Human, aa1-166, GST-Tag (Mitochondrial Fission Process Protein 1)

Product Overview

• Article Name: MTFP1, Recombinant, Human, aa1-166, GST-Tag (Mitochondrial Fission Process Protein 1)
• Biozol Catalog Number: USB-374305
• Supplier Catalog Number: 374305
• Alternative Catalog Number: USB-374305-20,USB-374305-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis. Source: Recombinant protein corresponding to aa1-166 from human MTFP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.0kD Amino Acid Sequence: MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 45
• UniProt: Q9UDX5
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.