Mup2, Recombinant, Mouse, aa19-180, His-Tag (Major Urinary Protein 2)

Product Overview

• Article Name: Mup2, Recombinant, Mouse, aa19-180, His-Tag (Major Urinary Protein 2)
• Biozol Catalog Number: USB-374325
• Supplier Catalog Number: 374325
• Alternative Catalog Number: USB-374325-20,USB-374325-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females. Source: Recombinant protein corresponding to aa19-180 from mouse Mup2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.7kD Amino Acid Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.7
• UniProt: P11589
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.