Mup6, Recombinant, Mouse, aa1-180, His-SUMO-Tag (Major Urinary Protein 6)

Product Overview

• Article Name: Mup6, Recombinant, Mouse, aa1-180, His-SUMO-Tag (Major Urinary Protein 6)
• Biozol Catalog Number: USB-374326
• Supplier Catalog Number: 374326
• Alternative Catalog Number: USB-374326-20,USB-374326-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females. Source: Recombinant protein corresponding to aa1-180 from mouse Mup6, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~36.6kD Amino Acid Sequence: MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 36.6
• UniProt: P02762
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.