MutT, Recombinant, E. coli, aa1-129, His-SUMO-Tag (8-Oxo-dGTP Diphosphatase)
Biozol Catalog Number:
USB-374331
Supplier Catalog Number:
374331
Alternative Catalog Number:
USB-374331-20,USB-374331-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Involved in the GO system responsible for removing an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool. 8-oxo-dGTP is inserted opposite dA and dC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT specifically degrades 8-oxo-dGTP to the monophosphate. Source: Recombinant protein corresponding to aa1-129 from E. coli 8-Oxo-dGTP Diphosphatase, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~30.9kD Amino Acid Sequence: MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted