MYCBP, Recombinant, Human, aa2-103, His-SUMO-Tag (C-Myc-binding Protein)

Catalog Number: USB-374339
Article Name: MYCBP, Recombinant, Human, aa2-103, His-SUMO-Tag (C-Myc-binding Protein)
Biozol Catalog Number: USB-374339
Supplier Catalog Number: 374339
Alternative Catalog Number: USB-374339-20,USB-374339-100,USB-374339-1
Manufacturer: US Biological
Category: Molekularbiologie
May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC. Source: Recombinant protein corresponding to aa2-103 from human MYCBP, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD Amino Acid Sequence: AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.8
UniProt: Q99417
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.