MYLPF, Recombinant, Human, aa2-169, His-SUMO-Tag (Myosin Regulatory Light Chain 2, Skeletal Muscle Isoform)

Catalog Number: USB-374352
Article Name: MYLPF, Recombinant, Human, aa2-169, His-SUMO-Tag (Myosin Regulatory Light Chain 2, Skeletal Muscle Isoform)
Biozol Catalog Number: USB-374352
Supplier Catalog Number: 374352
Alternative Catalog Number: USB-374352-20,USB-374352-100,USB-374352-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa2-169 from human MYLPF, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.9kD Amino Acid Sequence: APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.9
UniProt: Q96A32
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.