NAPRT1, Recombinant, Human, aa229-538, GST-Tag (Nicotinate Phosphoribosyltransferase)

Catalog Number: USB-374372
Article Name: NAPRT1, Recombinant, Human, aa229-538, GST-Tag (Nicotinate Phosphoribosyltransferase)
Biozol Catalog Number: USB-374372
Supplier Catalog Number: 374372
Alternative Catalog Number: USB-374372-20,USB-374372-100,USB-374372-1
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells. Source: Recombinant protein corresponding to aa229-538 from human NAPRT1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~60.2kD Amino Acid Sequence: MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 60.2
UniProt: Q6XQN6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.